Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) |
Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
Protein Serine hydroxymethyltransferase [53429] (6 species) |
Species Bacillus stearothermophilus [TaxId:1422] [75272] (7 PDB entries) |
Domain d1yjya1: 1yjy A:1-405 [123491] complexed with plp, ser; mutant |
PDB Entry: 1yjy (more details), 2.25 Å
SCOP Domain Sequences for d1yjya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yjya1 c.67.1.4 (A:1-405) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrry yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthmtlrgprggmilcqe qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd
Timeline for d1yjya1: