SCOP 1.73: Domain d1yjya1: 1yjy A:1-405

Lineage for d1yjya1 (1yjy A:1-405)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (8 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein Serine hydroxymethyltransferase [53429] (6 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [75272] (7 PDB entries)

8. Domain d1yjya1: 1yjy A:1-405 [123491]
   complexed with plp, ser; mutant

Details for d1yjya1

PDB Entry: 1yjy, 2.25 Å

PDB Description: K226M Mutant Of Serine Hydroxymethyltransferase From B. Stearothermophilus, Complex With Serine

PDB Compounds: (A:) serine hydroxymethyltransferase

SCOP Domain Sequences for d1yjya1:

Sequence; same for both SEQRES and ATOM records:

>d1yjya1 c.67.1.4 (A:1-405) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrry
yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthmtlrgprggmilcqe
qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd

Timeline for d1yjya1:

• d1yjya1 is new in SCOP 1.73
  
• d1yjya1 appears in SCOP 1.75
  
• d1yjya1 appears in the current release, SCOPe 2.08