Lineage for d1yjwx1 (1yjw X:7-88)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858025Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 858026Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 858027Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 858028Protein Ribosomal protein L31e [54577] (1 species)
  7. 858029Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 858052Domain d1yjwx1: 1yjw X:7-88 [123488]
    Other proteins in same PDB: d1yjw11, d1yjw21, d1yjw31, d1yjwa1, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwd1, d1yjwe1, d1yjwe2, d1yjwf1, d1yjwg1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwk1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwo1, d1yjwp1, d1yjwq1, d1yjwr1, d1yjws1, d1yjwt1, d1yjwu1, d1yjwv1, d1yjww1, d1yjwy1, d1yjwz1
    automatically matched to d1ffku_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, syb, ur3; mutant

Details for d1yjwx1

PDB Entry: 1yjw (more details), 2.9 Å

PDB Description: crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOP Domain Sequences for d1yjwx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjwx1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1yjwx1:

Click to download the PDB-style file with coordinates for d1yjwx1.
(The format of our PDB-style files is described here.)

Timeline for d1yjwx1: