Lineage for d1yjwv1 (1yjw V:1-65)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1077399Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1077416Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 1077417Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 1077418Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 1077459Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries)
    Uniprot P10971
  8. 1077478Domain d1yjwv1: 1yjw V:1-65 [123486]
    Other proteins in same PDB: d1yjw11, d1yjw21, d1yjw31, d1yjwa1, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwd1, d1yjwe1, d1yjwe2, d1yjwf1, d1yjwg1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwk1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwo1, d1yjwp1, d1yjwq1, d1yjwr1, d1yjws1, d1yjwt1, d1yjwu1, d1yjww1, d1yjwx1, d1yjwy1, d1yjwz1
    automatically matched to d1ffks_
    complexed with cd, cl, k, mg, na; mutant

Details for d1yjwv1

PDB Entry: 1yjw (more details), 2.9 Å

PDB Description: crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1yjwv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjwv1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1yjwv1:

Click to download the PDB-style file with coordinates for d1yjwv1.
(The format of our PDB-style files is described here.)

Timeline for d1yjwv1: