Lineage for d1yjws1 (1yjw S:1-81)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852675Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 852676Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 852677Family d.12.1.1: L23p [54190] (1 protein)
  6. 852678Protein Ribosomal protein L23 [54191] (4 species)
  7. 852679Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (62 PDB entries)
    Uniprot P12732
  8. 852715Domain d1yjws1: 1yjw S:1-81 [123483]
    Other proteins in same PDB: d1yjw11, d1yjw21, d1yjw31, d1yjwa1, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwd1, d1yjwe1, d1yjwe2, d1yjwf1, d1yjwg1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwk1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwo1, d1yjwp1, d1yjwq1, d1yjwr1, d1yjwt1, d1yjwu1, d1yjwv1, d1yjww1, d1yjwx1, d1yjwy1, d1yjwz1
    automatically matched to d1jj2r_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, syb, ur3; mutant

Details for d1yjws1

PDB Entry: 1yjw (more details), 2.9 Å

PDB Description: crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (S:) 50S ribosomal protein L23P

SCOP Domain Sequences for d1yjws1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjws1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOP Domain Coordinates for d1yjws1:

Click to download the PDB-style file with coordinates for d1yjws1.
(The format of our PDB-style files is described here.)

Timeline for d1yjws1: