Lineage for d1yjwp1 (1yjw P:1-143)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773657Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 773658Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 773659Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 773660Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 773661Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 773697Domain d1yjwp1: 1yjw P:1-143 [123480]
    Other proteins in same PDB: d1yjw11, d1yjw21, d1yjw31, d1yjwa1, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwd1, d1yjwe1, d1yjwe2, d1yjwf1, d1yjwg1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwk1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwo1, d1yjwq1, d1yjwr1, d1yjws1, d1yjwt1, d1yjwu1, d1yjwv1, d1yjww1, d1yjwx1, d1yjwy1, d1yjwz1
    automatically matched to d1s72p_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, syb, ur3; mutant

Details for d1yjwp1

PDB Entry: 1yjw (more details), 2.9 Å

PDB Description: crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOP Domain Sequences for d1yjwp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjwp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d1yjwp1:

Click to download the PDB-style file with coordinates for d1yjwp1.
(The format of our PDB-style files is described here.)

Timeline for d1yjwp1: