Lineage for d1yjwk1 (1yjw K:1-132)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798561Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 798562Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 798563Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 798564Protein Ribosomal protein L14 [50195] (5 species)
  7. 798565Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
    Uniprot P22450
  8. 798588Domain d1yjwk1: 1yjw K:1-132 [123475]
    Other proteins in same PDB: d1yjw11, d1yjw21, d1yjw31, d1yjwa1, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwd1, d1yjwe1, d1yjwe2, d1yjwf1, d1yjwg1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwo1, d1yjwp1, d1yjwq1, d1yjwr1, d1yjws1, d1yjwt1, d1yjwu1, d1yjwv1, d1yjww1, d1yjwx1, d1yjwy1, d1yjwz1
    automatically matched to d1s72k_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, syb, ur3; mutant

Details for d1yjwk1

PDB Entry: 1yjw (more details), 2.9 Å

PDB Description: crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOP Domain Sequences for d1yjwk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjwk1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1yjwk1:

Click to download the PDB-style file with coordinates for d1yjwk1.
(The format of our PDB-style files is described here.)

Timeline for d1yjwk1: