Lineage for d1yjwe1 (1yjw E:1-79)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041603Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1041604Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 1041605Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1041606Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1041686Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
    Uniprot P14135
  8. 1041723Domain d1yjwe1: 1yjw E:1-79 [123469]
    Other proteins in same PDB: d1yjw11, d1yjw21, d1yjw31, d1yjwa1, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwd1, d1yjwf1, d1yjwg1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwk1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwo1, d1yjwp1, d1yjwq1, d1yjwr1, d1yjws1, d1yjwt1, d1yjwu1, d1yjwv1, d1yjww1, d1yjwx1, d1yjwy1, d1yjwz1
    automatically matched to d1ffk11
    complexed with cd, cl, k, mg, na; mutant

Details for d1yjwe1

PDB Entry: 1yjw (more details), 2.9 Å

PDB Description: crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (E:) 50S ribosomal protein L6P

SCOPe Domain Sequences for d1yjwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjwe1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOPe Domain Coordinates for d1yjwe1:

Click to download the PDB-style file with coordinates for d1yjwe1.
(The format of our PDB-style files is described here.)

Timeline for d1yjwe1: