Lineage for d1yjwd1 (1yjw D:10-174)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209370Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 1209371Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 1209372Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 1209373Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 1209414Species Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries)
    Uniprot P14124
  8. 1209433Domain d1yjwd1: 1yjw D:10-174 [123468]
    Other proteins in same PDB: d1yjw11, d1yjw21, d1yjw31, d1yjwa1, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwe1, d1yjwe2, d1yjwf1, d1yjwg1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwk1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwo1, d1yjwp1, d1yjwq1, d1yjwr1, d1yjws1, d1yjwt1, d1yjwu1, d1yjwv1, d1yjww1, d1yjwx1, d1yjwy1, d1yjwz1
    automatically matched to d1ffkd_
    complexed with cd, cl, k, mg, na; mutant

Details for d1yjwd1

PDB Entry: 1yjw (more details), 2.9 Å

PDB Description: crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (D:) 50S ribosomal protein L5P

SCOPe Domain Sequences for d1yjwd1:

Sequence, based on SEQRES records: (download)

>d1yjwd1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1yjwd1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOPe Domain Coordinates for d1yjwd1:

Click to download the PDB-style file with coordinates for d1yjwd1.
(The format of our PDB-style files is described here.)

Timeline for d1yjwd1: