Lineage for d1yjwa1 (1yjw A:91-237)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946782Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 946945Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 946946Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 946985Species Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)
    Uniprot P20276
  8. 947004Domain d1yjwa1: 1yjw A:91-237 [123464]
    Other proteins in same PDB: d1yjw11, d1yjw21, d1yjw31, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwd1, d1yjwe1, d1yjwe2, d1yjwf1, d1yjwg1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwk1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwo1, d1yjwp1, d1yjwq1, d1yjwr1, d1yjws1, d1yjwt1, d1yjwu1, d1yjwv1, d1yjww1, d1yjwx1, d1yjwy1, d1yjwz1
    automatically matched to d1s72a1
    complexed with cd, cl, k, mg, na; mutant

Details for d1yjwa1

PDB Entry: 1yjw (more details), 2.9 Å

PDB Description: crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (A:) 50S ribosomal protein L2P

SCOPe Domain Sequences for d1yjwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjwa1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvagggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOPe Domain Coordinates for d1yjwa1:

Click to download the PDB-style file with coordinates for d1yjwa1.
(The format of our PDB-style files is described here.)

Timeline for d1yjwa1: