Lineage for d1yjw11 (1yjw 1:1-56)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066475Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1066537Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
  6. 1066538Protein Ribosomal protein L37e [57834] (1 species)
  7. 1066539Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
    Uniprot P32410
  8. 1066558Domain d1yjw11: 1yjw 1:1-56 [123462]
    Other proteins in same PDB: d1yjw21, d1yjw31, d1yjwa1, d1yjwa2, d1yjwb1, d1yjwc1, d1yjwd1, d1yjwe1, d1yjwe2, d1yjwf1, d1yjwg1, d1yjwh1, d1yjwi1, d1yjwj1, d1yjwk1, d1yjwl1, d1yjwm1, d1yjwn1, d1yjwo1, d1yjwp1, d1yjwq1, d1yjwr1, d1yjws1, d1yjwt1, d1yjwu1, d1yjwv1, d1yjww1, d1yjwx1, d1yjwy1, d1yjwz1
    automatically matched to d1ffkx_
    complexed with cd, cl, k, mg, na; mutant

Details for d1yjw11

PDB Entry: 1yjw (more details), 2.9 Å

PDB Description: crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d1yjw11:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjw11 g.41.8.2 (1:1-56) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d1yjw11:

Click to download the PDB-style file with coordinates for d1yjw11.
(The format of our PDB-style files is described here.)

Timeline for d1yjw11: