Lineage for d1yjsa1 (1yjs A:1-405)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896255Protein Serine hydroxymethyltransferase [53429] (7 species)
  7. 2896256Species Bacillus stearothermophilus [TaxId:1422] [75272] (39 PDB entries)
  8. 2896286Domain d1yjsa1: 1yjs A:1-405 [123461]
    complexed with plp; mutant

Details for d1yjsa1

PDB Entry: 1yjs (more details), 2 Å

PDB Description: K226Q Mutant Of Serine Hydroxymethyltransferase From B. Stearothermophilus, Complex With Glycine
PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d1yjsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjsa1 c.67.1.4 (A:1-405) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrry
yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthqtlrgprggmilcqe
qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd

SCOPe Domain Coordinates for d1yjsa1:

Click to download the PDB-style file with coordinates for d1yjsa1.
(The format of our PDB-style files is described here.)

Timeline for d1yjsa1: