Lineage for d1yjqa2 (1yjq A:1-167)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829821Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 1829921Protein Ketopantoate reductase PanE [69419] (1 species)
  7. 1829922Species Escherichia coli [TaxId:562] [69420] (4 PDB entries)
  8. 1829923Domain d1yjqa2: 1yjq A:1-167 [123460]
    Other proteins in same PDB: d1yjqa1
    automated match to d1ks9a2
    complexed with act, mpd, nap

Details for d1yjqa2

PDB Entry: 1yjq (more details), 2.09 Å

PDB Description: Crystal structure of ketopantoate reductase in complex with NADP+
PDB Compounds: (A:) 2-dehydropantoate 2-reductase

SCOPe Domain Sequences for d1yjqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjqa2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}
mkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlvetdgsifnesltandpdf
latsdlllvtlkawqvsdavkslastlpvttpillihngmgtieelqniqqpllmgttth
aarrdgnviihvangithigparqqdgdysyladilqtvlpdvawhn

SCOPe Domain Coordinates for d1yjqa2:

Click to download the PDB-style file with coordinates for d1yjqa2.
(The format of our PDB-style files is described here.)

Timeline for d1yjqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yjqa1