SCOPe 2.02: Domain d1yjqa2: 1yjq A:1-167

Lineage for d1yjqa2 (1yjq A:1-167)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Ketopantoate reductase PanE [69419] (1 species)

7. Species Escherichia coli [TaxId:562] [69420] (4 PDB entries)

8. Domain d1yjqa2: 1yjq A:1-167 [123460]
   Other proteins in same PDB: d1yjqa1
   automatically matched to d1ks9a2
   complexed with act, mpd, nap

Details for d1yjqa2

PDB Entry: 1yjq, 2.09 Å

PDB Description: Crystal structure of ketopantoate reductase in complex with NADP+

PDB Compounds: (A:) 2-dehydropantoate 2-reductase

SCOPe Domain Sequences for d1yjqa2:

Sequence; same for both SEQRES and ATOM records:

>d1yjqa2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}
mkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlvetdgsifnesltandpdf
latsdlllvtlkawqvsdavkslastlpvttpillihngmgtieelqniqqpllmgttth
aarrdgnviihvangithigparqqdgdysyladilqtvlpdvawhn

Timeline for d1yjqa2:

• d1yjqa2 first appeared in SCOP 1.73
  
• d1yjqa2 appears in SCOPe 2.01
  
• d1yjqa2 appears in SCOPe 2.03
  
• d1yjqa2 appears in the current release, SCOPe 2.08