SCOP 1.73: Domain d1yjqa1: 1yjq A:168-291

Lineage for d1yjqa1 (1yjq A:168-291)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.7: Ketopantoate reductase PanE [69084] (1 protein)

6. Protein Ketopantoate reductase PanE [69085] (1 species)

7. Species Escherichia coli [TaxId:562] [69086] (4 PDB entries)

8. Domain d1yjqa1: 1yjq A:168-291 [123459]
   Other proteins in same PDB: d1yjqa2
   automatically matched to d1ks9a1
   complexed with act, mpd, nap

Details for d1yjqa1

PDB Entry: 1yjq, 2.09 Å

PDB Description: Crystal structure of ketopantoate reductase in complex with NADP+

PDB Compounds: (A:) 2-dehydropantoate 2-reductase

SCOP Domain Sequences for d1yjqa1:

Sequence; same for both SEQRES and ATOM records:

>d1yjqa1 a.100.1.7 (A:168-291) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}
niraelwrklavncvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedl
rdyvmqvidataenissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkr
kese

Timeline for d1yjqa1:

• d1yjqa1 is new in SCOP 1.73
  
• d1yjqa1 appears in SCOP 1.75
  
• d1yjqa1 appears in the current release, SCOPe 2.08