SCOPe 2.08: Domain d1yjqa1: 1yjq A:168-293

Lineage for d1yjqa1 (1yjq A:168-293)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.7: Ketopantoate reductase PanE [69084] (1 protein)
   automatically mapped to Pfam PF08546

6. Protein Ketopantoate reductase PanE [69085] (1 species)

7. Species Escherichia coli [TaxId:562] [69086] (4 PDB entries)

8. Domain d1yjqa1: 1yjq A:168-293 [123459]
   Other proteins in same PDB: d1yjqa2
   automated match to d1ks9a1
   complexed with act, mpd, nap

Details for d1yjqa1

PDB Entry: 1yjq, 2.09 Å

PDB Description: Crystal structure of ketopantoate reductase in complex with NADP+

PDB Compounds: (A:) 2-dehydropantoate 2-reductase

SCOPe Domain Sequences for d1yjqa1:

Sequence; same for both SEQRES and ATOM records:

>d1yjqa1 a.100.1.7 (A:168-293) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}
niraelwrklavncvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedl
rdyvmqvidataenissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkr
keseye

Timeline for d1yjqa1:

• d1yjqa1 first appeared in SCOP 1.73
  
• d1yjqa1 appears in SCOPe 2.07