Lineage for d1yjnx1 (1yjn X:7-88)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200379Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 1200380Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 1200381Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 1200382Protein Ribosomal protein L31e [54577] (1 species)
  7. 1200383Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 1200407Domain d1yjnx1: 1yjn X:7-88 [123456]
    Other proteins in same PDB: d1yjn11, d1yjn21, d1yjn31, d1yjna1, d1yjna2, d1yjnb1, d1yjnc1, d1yjnd1, d1yjne1, d1yjne2, d1yjnf1, d1yjng1, d1yjnh1, d1yjni1, d1yjnj1, d1yjnk1, d1yjnl1, d1yjnm1, d1yjnn1, d1yjno1, d1yjnp1, d1yjnq1, d1yjnr1, d1yjns1, d1yjnt1, d1yjnu1, d1yjnv1, d1yjnw1, d1yjny1, d1yjnz1
    automatically matched to d1ffku_
    complexed with cd, cl, cly, k, mg, na; mutant

Details for d1yjnx1

PDB Entry: 1yjn (more details), 3 Å

PDB Description: crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d1yjnx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjnx1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOPe Domain Coordinates for d1yjnx1:

Click to download the PDB-style file with coordinates for d1yjnx1.
(The format of our PDB-style files is described here.)

Timeline for d1yjnx1: