Lineage for d1yjnu1 (1yjn U:4-56)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750455Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
  6. 750456Protein Ribosomal protein L24e [57750] (1 species)
  7. 750457Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
  8. 750491Domain d1yjnu1: 1yjn U:4-56 [123453]
    Other proteins in same PDB: d1yjn11, d1yjn31, d1yjna1, d1yjna2, d1yjnb1, d1yjnc1, d1yjnd1, d1yjne1, d1yjne2, d1yjnf1, d1yjnh1, d1yjni1, d1yjnj1, d1yjnk1, d1yjnl1, d1yjnm1, d1yjnn1, d1yjno1, d1yjnp1, d1yjnq1, d1yjnr1, d1yjns1, d1yjnt1, d1yjnv1, d1yjnw1, d1yjnx1, d1yjny1, d1yjnz1
    automatically matched to d1ffkr_
    complexed with 1ma, cd, cl, cly, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yjnu1

PDB Entry: 1yjn (more details), 3 Å

PDB Description: crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOP Domain Sequences for d1yjnu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjnu1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOP Domain Coordinates for d1yjnu1:

Click to download the PDB-style file with coordinates for d1yjnu1.
(The format of our PDB-style files is described here.)

Timeline for d1yjnu1: