SCOPe 2.05: Domain d1yjnt1: 1yjn T:1-119

Lineage for d1yjnt1 (1yjn T:1-119)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (4 species)

7. Species Haloarcula marismortui [TaxId:2238] [50107] (40 PDB entries)
   Uniprot P10972

8. Domain d1yjnt1: 1yjn T:1-119 [123452]
   Other proteins in same PDB: d1yjn11, d1yjn21, d1yjn31, d1yjna1, d1yjna2, d1yjnb1, d1yjnc1, d1yjnd1, d1yjne1, d1yjne2, d1yjnf1, d1yjng1, d1yjnh1, d1yjni1, d1yjnj1, d1yjnk1, d1yjnl1, d1yjnm1, d1yjnn1, d1yjno1, d1yjnp1, d1yjnq1, d1yjnr1, d1yjns1, d1yjnu1, d1yjnv1, d1yjnw1, d1yjnx1, d1yjny1, d1yjnz1
   automatically matched to d1ffkq_
   complexed with cd, cl, cly, k, mg, na; mutant

Details for d1yjnt1

PDB Entry: 1yjn, 3 Å

PDB Description: crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (T:) 50S ribosomal protein L24P

SCOPe Domain Sequences for d1yjnt1:

Sequence; same for both SEQRES and ATOM records:

>d1yjnt1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

Timeline for d1yjnt1:

• d1yjnt1 first appeared in SCOP 1.73
  
• d1yjnt1 appears in SCOPe 2.04
  
• d1yjnt1 appears in SCOPe 2.06
  
• d1yjnt1 appears in the current release, SCOPe 2.08