Lineage for d1yjnp1 (1yjn P:1-143)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1093554Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 1093555Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 1093556Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 1093557Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 1093558Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 1093598Domain d1yjnp1: 1yjn P:1-143 [123448]
    Other proteins in same PDB: d1yjn11, d1yjn21, d1yjn31, d1yjna1, d1yjna2, d1yjnb1, d1yjnc1, d1yjnd1, d1yjne1, d1yjne2, d1yjnf1, d1yjng1, d1yjnh1, d1yjni1, d1yjnj1, d1yjnk1, d1yjnl1, d1yjnm1, d1yjnn1, d1yjno1, d1yjnq1, d1yjnr1, d1yjns1, d1yjnt1, d1yjnu1, d1yjnv1, d1yjnw1, d1yjnx1, d1yjny1, d1yjnz1
    automatically matched to d1s72p_
    complexed with cd, cl, cly, k, mg, na; mutant

Details for d1yjnp1

PDB Entry: 1yjn (more details), 3 Å

PDB Description: crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d1yjnp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjnp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d1yjnp1:

Click to download the PDB-style file with coordinates for d1yjnp1.
(The format of our PDB-style files is described here.)

Timeline for d1yjnp1: