Lineage for d1yjnn1 (1yjn N:1-186)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1860419Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 1860420Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 1860421Protein Ribosomal protein L18 (L18p) [53139] (5 species)
  7. 1860461Species Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries)
    Uniprot P14123
  8. 1860485Domain d1yjnn1: 1yjn N:1-186 [123446]
    Other proteins in same PDB: d1yjn11, d1yjn21, d1yjn31, d1yjna1, d1yjna2, d1yjnb1, d1yjnc1, d1yjnd1, d1yjne1, d1yjne2, d1yjnf1, d1yjng1, d1yjnh1, d1yjni1, d1yjnj1, d1yjnk1, d1yjnl1, d1yjnm1, d1yjno1, d1yjnp1, d1yjnq1, d1yjnr1, d1yjns1, d1yjnt1, d1yjnu1, d1yjnv1, d1yjnw1, d1yjnx1, d1yjny1, d1yjnz1
    automatically matched to d1ffkk_
    complexed with cd, cl, cly, k, mg, na; mutant

Details for d1yjnn1

PDB Entry: 1yjn (more details), 3 Å

PDB Description: crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (N:) 50S ribosomal protein L18P

SCOPe Domain Sequences for d1yjnn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjnn1 c.55.4.1 (N:1-186) Ribosomal protein L18 (L18p) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOPe Domain Coordinates for d1yjnn1:

Click to download the PDB-style file with coordinates for d1yjnn1.
(The format of our PDB-style files is described here.)

Timeline for d1yjnn1: