Lineage for d1yjnk1 (1yjn K:1-132)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798561Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 798562Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 798563Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 798564Protein Ribosomal protein L14 [50195] (5 species)
  7. 798565Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
    Uniprot P22450
  8. 798592Domain d1yjnk1: 1yjn K:1-132 [123443]
    Other proteins in same PDB: d1yjn11, d1yjn21, d1yjn31, d1yjna1, d1yjna2, d1yjnb1, d1yjnc1, d1yjnd1, d1yjne1, d1yjne2, d1yjnf1, d1yjng1, d1yjnh1, d1yjni1, d1yjnj1, d1yjnl1, d1yjnm1, d1yjnn1, d1yjno1, d1yjnp1, d1yjnq1, d1yjnr1, d1yjns1, d1yjnt1, d1yjnu1, d1yjnv1, d1yjnw1, d1yjnx1, d1yjny1, d1yjnz1
    automatically matched to d1s72k_
    complexed with 1ma, cd, cl, cly, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yjnk1

PDB Entry: 1yjn (more details), 3 Å

PDB Description: crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOP Domain Sequences for d1yjnk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjnk1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1yjnk1:

Click to download the PDB-style file with coordinates for d1yjnk1.
(The format of our PDB-style files is described here.)

Timeline for d1yjnk1: