Lineage for d1yjnd1 (1yjn D:10-174)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727201Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 727202Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) (S)
  5. 727203Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 727204Protein Ribosomal protein L5 [55284] (3 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 727205Species Archaeon Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries)
  8. 727239Domain d1yjnd1: 1yjn D:10-174 [123436]
    Other proteins in same PDB: d1yjn11, d1yjn31, d1yjna1, d1yjna2, d1yjnb1, d1yjnc1, d1yjne1, d1yjne2, d1yjnf1, d1yjnh1, d1yjni1, d1yjnj1, d1yjnk1, d1yjnl1, d1yjnm1, d1yjnn1, d1yjno1, d1yjnp1, d1yjnq1, d1yjnr1, d1yjns1, d1yjnt1, d1yjnu1, d1yjnv1, d1yjnw1, d1yjnx1, d1yjny1, d1yjnz1
    automatically matched to d1ffkd_
    complexed with 1ma, cd, cl, cly, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yjnd1

PDB Entry: 1yjn (more details), 3 Å

PDB Description: crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (D:) 50S ribosomal protein L5P

SCOP Domain Sequences for d1yjnd1:

Sequence, based on SEQRES records: (download)

>d1yjnd1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1yjnd1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOP Domain Coordinates for d1yjnd1:

Click to download the PDB-style file with coordinates for d1yjnd1.
(The format of our PDB-style files is described here.)

Timeline for d1yjnd1: