SCOPe 2.07: Domain d1yjnb1: 1yjn B:1-337

Lineage for d1yjnb1 (1yjn B:1-337)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
   automatically mapped to Pfam PF00297

6. Protein Ribosomal protein L3 [50462] (4 species)
   superfamily fold is elaborated with additional structures

7. Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
   Uniprot P20279

8. Domain d1yjnb1: 1yjn B:1-337 [123434]
   Other proteins in same PDB: d1yjn11, d1yjn21, d1yjn31, d1yjna1, d1yjna2, d1yjnc1, d1yjnd1, d1yjne1, d1yjne2, d1yjnf1, d1yjng1, d1yjnh1, d1yjni1, d1yjnj1, d1yjnk1, d1yjnl1, d1yjnm1, d1yjnn1, d1yjno1, d1yjnp1, d1yjnq1, d1yjnr1, d1yjns1, d1yjnt1, d1yjnu1, d1yjnv1, d1yjnw1, d1yjnx1, d1yjny1, d1yjnz1
   automatically matched to d1jj2b_
   complexed with cd, cl, cly, k, mg, na; mutant

Details for d1yjnb1

PDB Entry: 1yjn, 3 Å

PDB Description: crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (B:) 50S ribosomal protein L3P

SCOPe Domain Sequences for d1yjnb1:

Sequence; same for both SEQRES and ATOM records:

>d1yjnb1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

Timeline for d1yjnb1:

• d1yjnb1 first appeared in SCOP 1.73
  
• d1yjnb1 appears in SCOPe 2.06
  
• d1yjnb1 appears in the current release, SCOPe 2.08