SCOPe 2.07: Domain d1yjmc_: 1yjm C:

Lineage for d1yjmc_ (1yjm C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.2: FHA domain [49885] (12 proteins)

6. Protein Polynucleotide kinase 3'-phosphatase [101628] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101629] (3 PDB entries)

8. Domain d1yjmc_: 1yjm C: [123429]
   automated match to d1yjma1
   protein/DNA complex

Details for d1yjmc_

PDB Entry: 1yjm, 2.2 Å

PDB Description: Crystal structure of the FHA domain of mouse polynucleotide kinase in complex with an XRCC4-derived phosphopeptide.

PDB Compounds: (C:) Polynucleotide 5'-hydroxyl-kinase

SCOPe Domain Sequences for d1yjmc_:

Sequence; same for both SEQRES and ATOM records:

>d1yjmc_ b.26.1.2 (C:) Polynucleotide kinase 3'-phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
rgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesrtvavkq
lgvnpstvgvhelkpglsgslslgdvlylvnglypltlrwe

Timeline for d1yjmc_:

• d1yjmc_ first appeared in SCOP 1.73, called d1yjmc1
  
• d1yjmc_ appears in SCOPe 2.06
  
• d1yjmc_ appears in the current release, SCOPe 2.08