SCOP 1.75: Domain d1yjmc1: 1yjm C:7-107

Lineage for d1yjmc1 (1yjm C:7-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (4 families)
   has a few short helices inserted in loops

5. Family b.26.1.2: FHA domain [49885] (11 proteins)

6. Protein Polynucleotide kinase 3'-phosphatase [101628] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101629] (3 PDB entries)

8. Domain d1yjmc1: 1yjm C:7-107 [123429]
   automatically matched to 1YJM A:4-110
   complexed with ace

Details for d1yjmc1

PDB Entry: 1yjm, 2.2 Å

PDB Description: Crystal structure of the FHA domain of mouse polynucleotide kinase in complex with an XRCC4-derived phosphopeptide.

PDB Compounds: (C:) Polynucleotide 5'-hydroxyl-kinase

SCOP Domain Sequences for d1yjmc1:

Sequence; same for both SEQRES and ATOM records:

>d1yjmc1 b.26.1.2 (C:7-107) Polynucleotide kinase 3'-phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
rgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesrtvavkq
lgvnpstvgvhelkpglsgslslgdvlylvnglypltlrwe

Timeline for d1yjmc1:

• d1yjmc1 first appeared in SCOP 1.73
  
• d1yjmc1 is called d1yjmc_ in SCOPe 2.01
  
• d1yjmc1 appears in the current release, SCOPe 2.08, called d1yjmc_