![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
![]() | Superfamily b.26.1: SMAD/FHA domain [49879] (4 families) ![]() has a few short helices inserted in loops |
![]() | Family b.26.1.2: FHA domain [49885] (11 proteins) |
![]() | Protein Polynucleotide kinase 3'-phosphatase [101628] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [101629] (3 PDB entries) |
![]() | Domain d1yjmc1: 1yjm C:7-107 [123429] automatically matched to 1YJM A:4-110 complexed with ace |
PDB Entry: 1yjm (more details), 2.2 Å
SCOP Domain Sequences for d1yjmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yjmc1 b.26.1.2 (C:7-107) Polynucleotide kinase 3'-phosphatase {Mouse (Mus musculus) [TaxId: 10090]} rgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesrtvavkq lgvnpstvgvhelkpglsgslslgdvlylvnglypltlrwe
Timeline for d1yjmc1: