Lineage for d1yjmb1 (1yjm B:6-110)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663035Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 663036Superfamily b.26.1: SMAD/FHA domain [49879] (4 families) (S)
    has a few short helices inserted in loops
  5. 663070Family b.26.1.2: FHA domain [49885] (11 proteins)
  6. 663118Protein Polynucleotide kinase 3'-phosphatase [101628] (2 species)
  7. 663121Species Mouse (Mus musculus) [TaxId:10090] [101629] (3 PDB entries)
  8. 663123Domain d1yjmb1: 1yjm B:6-110 [123428]
    automatically matched to 1YJM A:4-110
    complexed with ace

Details for d1yjmb1

PDB Entry: 1yjm (more details), 2.2 Å

PDB Description: Crystal structure of the FHA domain of mouse polynucleotide kinase in complex with an XRCC4-derived phosphopeptide.
PDB Compounds: (B:) Polynucleotide 5'-hydroxyl-kinase

SCOP Domain Sequences for d1yjmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjmb1 b.26.1.2 (B:6-110) Polynucleotide kinase 3'-phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
srgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesrtvavk
qlgvnpstvgvhelkpglsgslslgdvlylvnglypltlrweels

SCOP Domain Coordinates for d1yjmb1:

Click to download the PDB-style file with coordinates for d1yjmb1.
(The format of our PDB-style files is described here.)

Timeline for d1yjmb1: