![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.1: PHM/PNGase F [49742] (2 families) ![]() members of this superfamily bind peptide substrates duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits |
![]() | Family b.121.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein) |
![]() | Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [49748] (26 PDB entries) |
![]() | Domain d1yjka1: 1yjk A:50-198 [123423] automated match to d3miha1 complexed with cu, gol |
PDB Entry: 1yjk (more details), 2 Å
SCOPe Domain Sequences for d1yjka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yjka1 b.121.1.2 (A:50-198) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]} tigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdtvhhm llfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgskyfvl qvhygdisafrdnhkdcsgvsvhltrvpq
Timeline for d1yjka1: