SCOPe 2.06: Domain d1yjha_: 1yjh A:

Lineage for d1yjha_ (1yjh A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins)

6. Protein automated matches [190040] (1 species)
   not a true protein

7. Species Bedbug (Cimex lectularius) [TaxId:79782] [186761] (7 PDB entries)

8. Domain d1yjha_: 1yjh A: [123420]
   automated match to d1ntfa_
   complexed with hem, no

Details for d1yjha_

PDB Entry: 1yjh, 1.65 Å

PDB Description: Crystal Structure of Cimex Nitrophorin Ferrous NO Complex

PDB Compounds: (A:) Salivary nitrophorin

SCOPe Domain Sequences for d1yjha_:

Sequence; same for both SEQRES and ATOM records:

>d1yjha_ d.151.1.2 (A:) automated matches {Bedbug (Cimex lectularius) [TaxId: 79782]}
ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl

Timeline for d1yjha_:

• d1yjha_ first appeared in SCOP 1.73, called d1yjha1
  
• d1yjha_ appears in SCOPe 2.05
  
• d1yjha_ appears in SCOPe 2.07
  
• d1yjha_ appears in the current release, SCOPe 2.08