Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) |
Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins) |
Protein automated matches [190040] (1 species) not a true protein |
Species Bedbug (Cimex lectularius) [TaxId:79782] [186761] (3 PDB entries) |
Domain d1yjha_: 1yjh A: [123420] automated match to d1ntfa_ complexed with hem, no |
PDB Entry: 1yjh (more details), 1.65 Å
SCOPe Domain Sequences for d1yjha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yjha_ d.151.1.2 (A:) automated matches {Bedbug (Cimex lectularius) [TaxId: 79782]} ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl
Timeline for d1yjha_: