Lineage for d1yjha1 (1yjh A:3-282)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735706Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 735707Superfamily d.151.1: DNase I-like [56219] (3 families) (S)
  5. 735755Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (2 proteins)
  6. 735756Protein Salivary nitrophorin [103310] (1 species)
    heme-binding homologue of IPP5
  7. 735757Species Bedbug (Cimex lectularius) [TaxId:79782] [103311] (4 PDB entries)
  8. 735761Domain d1yjha1: 1yjh A:3-282 [123420]
    automatically matched to d1ntfa_
    complexed with hem, no

Details for d1yjha1

PDB Entry: 1yjh (more details), 1.65 Å

PDB Description: Crystal Structure of Cimex Nitrophorin Ferrous NO Complex
PDB Compounds: (A:) Salivary nitrophorin

SCOP Domain Sequences for d1yjha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjha1 d.151.1.2 (A:3-282) Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId: 79782]}
ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl

SCOP Domain Coordinates for d1yjha1:

Click to download the PDB-style file with coordinates for d1yjha1.
(The format of our PDB-style files is described here.)

Timeline for d1yjha1: