Lineage for d1yjha_ (1yjh A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548624Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins)
  6. 2548634Protein automated matches [190040] (1 species)
    not a true protein
  7. 2548635Species Bedbug (Cimex lectularius) [TaxId:79782] [186761] (7 PDB entries)
  8. 2548638Domain d1yjha_: 1yjh A: [123420]
    automated match to d1ntfa_
    complexed with hem, no

Details for d1yjha_

PDB Entry: 1yjh (more details), 1.65 Å

PDB Description: Crystal Structure of Cimex Nitrophorin Ferrous NO Complex
PDB Compounds: (A:) Salivary nitrophorin

SCOPe Domain Sequences for d1yjha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjha_ d.151.1.2 (A:) automated matches {Bedbug (Cimex lectularius) [TaxId: 79782]}
ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl

SCOPe Domain Coordinates for d1yjha_:

Click to download the PDB-style file with coordinates for d1yjha_.
(The format of our PDB-style files is described here.)

Timeline for d1yjha_: