Lineage for d1yj9u1 (1yj9 U:4-56)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705142Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1705143Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1705409Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
    automatically mapped to Pfam PF01246
  6. 1705410Protein Ribosomal protein L24e [57750] (1 species)
  7. 1705411Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
    Uniprot P14116
  8. 1705437Domain d1yj9u1: 1yj9 U:4-56 [123413]
    Other proteins in same PDB: d1yj911, d1yj921, d1yj931, d1yj9a1, d1yj9a2, d1yj9b1, d1yj9c1, d1yj9d1, d1yj9e1, d1yj9e2, d1yj9f1, d1yj9g1, d1yj9h1, d1yj9i1, d1yj9j1, d1yj9k1, d1yj9l1, d1yj9m1, d1yj9n1, d1yj9o1, d1yj9p1, d1yj9q1, d1yj9r1, d1yj9s1, d1yj9t1, d1yj9v1, d1yj9w1, d1yj9x1, d1yj9y1, d1yj9z1
    automatically matched to d1ffkr_
    complexed with cd, cl, k, mg, na; mutant

Details for d1yj9u1

PDB Entry: 1yj9 (more details), 2.9 Å

PDB Description: Crystal Structure Of The Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui Containing a three residue deletion in L22
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d1yj9u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj9u1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d1yj9u1:

Click to download the PDB-style file with coordinates for d1yj9u1.
(The format of our PDB-style files is described here.)

Timeline for d1yj9u1: