Lineage for d1yj9s1 (1yj9 S:1-81)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1193691Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 1193692Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 1193693Family d.12.1.1: L23p [54190] (1 protein)
  6. 1193694Protein Ribosomal protein L23 [54191] (4 species)
  7. 1193733Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries)
    Uniprot P12732
  8. 1193775Domain d1yj9s1: 1yj9 S:1-81 [123411]
    Other proteins in same PDB: d1yj911, d1yj921, d1yj931, d1yj9a1, d1yj9a2, d1yj9b1, d1yj9c1, d1yj9d1, d1yj9e1, d1yj9e2, d1yj9f1, d1yj9g1, d1yj9h1, d1yj9i1, d1yj9j1, d1yj9k1, d1yj9l1, d1yj9m1, d1yj9n1, d1yj9o1, d1yj9p1, d1yj9q1, d1yj9r1, d1yj9t1, d1yj9u1, d1yj9v1, d1yj9w1, d1yj9x1, d1yj9y1, d1yj9z1
    automatically matched to d1jj2r_
    complexed with cd, cl, k, mg, na; mutant

Details for d1yj9s1

PDB Entry: 1yj9 (more details), 2.9 Å

PDB Description: Crystal Structure Of The Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui Containing a three residue deletion in L22
PDB Compounds: (S:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d1yj9s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj9s1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOPe Domain Coordinates for d1yj9s1:

Click to download the PDB-style file with coordinates for d1yj9s1.
(The format of our PDB-style files is described here.)

Timeline for d1yj9s1: