SCOPe 2.05: Domain d1yj9q1: 1yj9 Q:1-95

Lineage for d1yj9q1 (1yj9 Q:1-95)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L21e [50108] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
   Uniprot P12734

8. Domain d1yj9q1: 1yj9 Q:1-95 [123410]
   Other proteins in same PDB: d1yj911, d1yj921, d1yj931, d1yj9a1, d1yj9a2, d1yj9b1, d1yj9c1, d1yj9d1, d1yj9e1, d1yj9e2, d1yj9f1, d1yj9g1, d1yj9h1, d1yj9i1, d1yj9j1, d1yj9k1, d1yj9l1, d1yj9m1, d1yj9n1, d1yj9o1, d1yj9p1, d1yj9r1, d1yj9s1, d1yj9t1, d1yj9u1, d1yj9v1, d1yj9w1, d1yj9x1, d1yj9y1, d1yj9z1
   automatically matched to d1ffkn_
   complexed with cd, cl, k, mg, na; mutant

Details for d1yj9q1

PDB Entry: 1yj9, 2.9 Å

PDB Description: Crystal Structure Of The Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui Containing a three residue deletion in L22

PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOPe Domain Sequences for d1yj9q1:

Sequence; same for both SEQRES and ATOM records:

>d1yj9q1 b.34.5.1 (Q:1-95) Ribosomal proteins L21e {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

Timeline for d1yj9q1:

• d1yj9q1 first appeared in SCOP 1.73
  
• d1yj9q1 appears in SCOPe 2.04
  
• d1yj9q1 appears in SCOPe 2.06
  
• d1yj9q1 appears in the current release, SCOPe 2.08