Lineage for d1yj9o1 (1yj9 O:1-115)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835020Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 1835021Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 1835022Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 1835114Protein Ribosomal protein L18e [52084] (1 species)
  7. 1835115Species Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
    Uniprot P12733
  8. 1835141Domain d1yj9o1: 1yj9 O:1-115 [123408]
    Other proteins in same PDB: d1yj911, d1yj921, d1yj931, d1yj9a1, d1yj9a2, d1yj9b1, d1yj9c1, d1yj9d1, d1yj9e1, d1yj9e2, d1yj9f1, d1yj9g1, d1yj9h1, d1yj9i1, d1yj9j1, d1yj9k1, d1yj9l1, d1yj9m1, d1yj9n1, d1yj9p1, d1yj9q1, d1yj9r1, d1yj9s1, d1yj9t1, d1yj9u1, d1yj9v1, d1yj9w1, d1yj9x1, d1yj9y1, d1yj9z1
    automatically matched to d1ffkl_
    complexed with cd, cl, k, mg, na; mutant

Details for d1yj9o1

PDB Entry: 1yj9 (more details), 2.9 Å

PDB Description: Crystal Structure Of The Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui Containing a three residue deletion in L22
PDB Compounds: (O:) 50S ribosomal protein L18e

SCOPe Domain Sequences for d1yj9o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj9o1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOPe Domain Coordinates for d1yj9o1:

Click to download the PDB-style file with coordinates for d1yj9o1.
(The format of our PDB-style files is described here.)

Timeline for d1yj9o1: