SCOP 1.73: Domain d1yj9o1: 1yj9 O:1-115

Lineage for d1yj9o1 (1yj9 O:1-115)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
   core: three turns of irregular (beta-beta-alpha)n superhelix

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L18e [52084] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)

8. Domain d1yj9o1: 1yj9 O:1-115 [123408]
   Other proteins in same PDB: d1yj911, d1yj931, d1yj9a1, d1yj9a2, d1yj9b1, d1yj9c1, d1yj9d1, d1yj9e1, d1yj9e2, d1yj9f1, d1yj9h1, d1yj9i1, d1yj9j1, d1yj9k1, d1yj9l1, d1yj9m1, d1yj9n1, d1yj9p1, d1yj9q1, d1yj9s1, d1yj9t1, d1yj9u1, d1yj9v1, d1yj9w1, d1yj9x1, d1yj9y1, d1yj9z1
   automatically matched to d1ffkl_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yj9o1

PDB Entry: 1yj9, 2.9 Å

PDB Description: Crystal Structure Of The Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui Containing a three residue deletion in L22

PDB Compounds: (O:) 50S ribosomal protein L18e

SCOP Domain Sequences for d1yj9o1:

Sequence; same for both SEQRES and ATOM records:

>d1yj9o1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Archaeon Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

Timeline for d1yj9o1:

• d1yj9o1 is new in SCOP 1.73
  
• d1yj9o1 appears in SCOP 1.75
  
• d1yj9o1 appears in the current release, SCOPe 2.08