SCOP 1.73: Domain d1yj9a2: 1yj9 A:1-90

Lineage for d1yj9a2 (1yj9 A:1-90)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
   incomplete OB-fold lacking the last strand

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
   includes the N-terminal tail

8. Domain d1yj9a2: 1yj9 A:1-90 [123394]
   Other proteins in same PDB: d1yj911, d1yj931, d1yj9a1, d1yj9b1, d1yj9c1, d1yj9d1, d1yj9e1, d1yj9e2, d1yj9f1, d1yj9h1, d1yj9i1, d1yj9j1, d1yj9k1, d1yj9l1, d1yj9m1, d1yj9n1, d1yj9o1, d1yj9p1, d1yj9q1, d1yj9s1, d1yj9t1, d1yj9u1, d1yj9v1, d1yj9w1, d1yj9x1, d1yj9y1, d1yj9z1
   automatically matched to d1s72a2
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yj9a2

PDB Entry: 1yj9, 2.9 Å

PDB Description: Crystal Structure Of The Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui Containing a three residue deletion in L22

PDB Compounds: (A:) 50S ribosomal protein L2P

SCOP Domain Sequences for d1yj9a2:

Sequence; same for both SEQRES and ATOM records:

>d1yj9a2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvsaeiap

Timeline for d1yj9a2:

• d1yj9a2 is new in SCOP 1.73
  
• d1yj9a2 appears in SCOP 1.75
  
• d1yj9a2 appears in the current release, SCOPe 2.08