Lineage for d1yj9a1 (1yj9 A:91-237)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665509Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) (S)
    many known members contain KOW motif
  5. 665631Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 665632Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)
  7. 665633Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)
  8. 665666Domain d1yj9a1: 1yj9 A:91-237 [123393]
    Other proteins in same PDB: d1yj911, d1yj931, d1yj9a2, d1yj9b1, d1yj9c1, d1yj9d1, d1yj9e1, d1yj9e2, d1yj9f1, d1yj9h1, d1yj9i1, d1yj9j1, d1yj9k1, d1yj9l1, d1yj9m1, d1yj9n1, d1yj9o1, d1yj9p1, d1yj9q1, d1yj9s1, d1yj9t1, d1yj9u1, d1yj9v1, d1yj9w1, d1yj9x1, d1yj9y1, d1yj9z1
    automatically matched to d1s72a1
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yj9a1

PDB Entry: 1yj9 (more details), 2.9 Å

PDB Description: Crystal Structure Of The Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui Containing a three residue deletion in L22
PDB Compounds: (A:) 50S ribosomal protein L2P

SCOP Domain Sequences for d1yj9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj9a1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvagggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOP Domain Coordinates for d1yj9a1:

Click to download the PDB-style file with coordinates for d1yj9a1.
(The format of our PDB-style files is described here.)

Timeline for d1yj9a1: