SCOP 1.75: Domain d1yj911: 1yj9 1:1-56

Lineage for d1yj911 (1yj9 1:1-56)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)

6. Protein Ribosomal protein L37e [57834] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
   Uniprot P32410

8. Domain d1yj911: 1yj9 1:1-56 [123391]
   Other proteins in same PDB: d1yj921, d1yj931, d1yj9a1, d1yj9a2, d1yj9b1, d1yj9c1, d1yj9d1, d1yj9e1, d1yj9e2, d1yj9f1, d1yj9g1, d1yj9h1, d1yj9i1, d1yj9j1, d1yj9k1, d1yj9l1, d1yj9m1, d1yj9n1, d1yj9o1, d1yj9p1, d1yj9q1, d1yj9r1, d1yj9s1, d1yj9t1, d1yj9u1, d1yj9v1, d1yj9w1, d1yj9x1, d1yj9y1, d1yj9z1
   automatically matched to d1ffkx_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yj911

PDB Entry: 1yj9, 2.9 Å

PDB Description: Crystal Structure Of The Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui Containing a three residue deletion in L22

PDB Compounds: (1:) 50S ribosomal protein L37e

SCOP Domain Sequences for d1yj911:

Sequence; same for both SEQRES and ATOM records:

>d1yj911 g.41.8.2 (1:1-56) Ribosomal protein L37e {Archaeon Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

Timeline for d1yj911:

• d1yj911 first appeared in SCOP 1.73
  
• d1yj911 appears in SCOPe 2.01
  
• d1yj911 appears in the current release, SCOPe 2.08