SCOP 1.73: Domain d1yj6b1: 1yj6 B:85-217

Lineage for d1yj6b1 (1yj6 B:85-217)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)

8. Domain d1yj6b1: 1yj6 B:85-217 [123387]
   Other proteins in same PDB: d1yj6a2, d1yj6b2, d1yj6c2
   automatically matched to d1gtua1
   complexed with gsh, zn

Details for d1yj6b1

PDB Entry: 1yj6, 2.5 Å

PDB Description: crystal structure of human glutathione s-transferase m1a-1a complexed with glutathionyl-zinc-trihydroxide

PDB Compounds: (B:) Glutathione S-transferase Mu 1

SCOP Domain Sequences for d1yj6b1:

Sequence; same for both SEQRES and ATOM records:

>d1yj6b1 a.45.1.1 (B:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

Timeline for d1yj6b1:

• d1yj6b1 is new in SCOP 1.73
  
• d1yj6b1 appears in SCOP 1.75
  
• d1yj6b1 appears in the current release, SCOPe 2.08