Lineage for d1yj6a1 (1yj6 A:85-217)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769705Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 769706Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 769707Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 769870Protein Class mu GST [81348] (3 species)
  7. 769878Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)
    Uniprot P09488 P28161
  8. 769895Domain d1yj6a1: 1yj6 A:85-217 [123385]
    Other proteins in same PDB: d1yj6a2, d1yj6b2, d1yj6c2
    automatically matched to d1gtua1
    complexed with gsh, zn

Details for d1yj6a1

PDB Entry: 1yj6 (more details), 2.5 Å

PDB Description: crystal structure of human glutathione s-transferase m1a-1a complexed with glutathionyl-zinc-trihydroxide
PDB Compounds: (A:) Glutathione S-transferase Mu 1

SCOP Domain Sequences for d1yj6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj6a1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOP Domain Coordinates for d1yj6a1:

Click to download the PDB-style file with coordinates for d1yj6a1.
(The format of our PDB-style files is described here.)

Timeline for d1yj6a1: