SCOPe 2.07: Domain d1yj5b2: 1yj5 B:351-522

Lineage for d1yj5b2 (1yj5 B:351-522)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein 5' polynucleotide kinase-3' phosphatase, C-terminal domain [142213] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [142214] (1 PDB entry)
   Uniprot Q9JLV6 351-522

8. Domain d1yj5b2: 1yj5 B:351-522 [123383]
   Other proteins in same PDB: d1yj5a1, d1yj5b1, d1yj5c1
   automatically matched to 1YJ5 A:351-522
   complexed with so4

Details for d1yj5b2

PDB Entry: 1yj5, 2.8 Å

PDB Description: Molecular architecture of mammalian polynucleotide kinase, a DNA repair enzyme

PDB Compounds: (B:) 5' polynucleotide kinase-3' phosphatase catalytic domain

SCOPe Domain Sequences for d1yj5b2:

Sequence; same for both SEQRES and ATOM records:

>d1yj5b2 c.37.1.1 (B:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
lylpesssllspnpevvvavgfpgagkstfiqehlvsagyvhvnrdtlgswqrcvsscqa
alrqgkrvvidntnpdvpsraryiqcakdagvpcrcfnfcatieqarhnnrfremtdpsh
apvsdmvmfsyrkqfepptlaegfleileipfrlqehldpalqrlyrqfseg

Timeline for d1yj5b2:

• d1yj5b2 first appeared in SCOP 1.73
  
• d1yj5b2 appears in SCOPe 2.06
  
• d1yj5b2 appears in the current release, SCOPe 2.08