Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (121 species) not a true protein |
Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [186876] (5 PDB entries) |
Domain d1yiza_: 1yiz A: [123375] automated match to d1w7la_ complexed with br |
PDB Entry: 1yiz (more details), 1.55 Å
SCOPe Domain Sequences for d1yiza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yiza_ c.67.1.0 (A:) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]} kfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdplan qytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdeviii epffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiintp hnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertitig sagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlkspe cyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkdy rftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss
Timeline for d1yiza_: