Lineage for d1yiza1 (1yiz A:12-429)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705329Family c.67.1.1: AAT-like [53384] (16 protein domains)
  6. 705583Protein Kynurenine--oxoglutarate transaminase I [110681] (2 species)
  7. 705588Species Yellowfever mosquito (Aedes aegypti) [TaxId:7159] [142654] (2 PDB entries)
  8. 705589Domain d1yiza1: 1yiz A:12-429 [123375]
    automatically matched to 1YIY A:12-429
    complexed with br

Details for d1yiza1

PDB Entry: 1yiz (more details), 1.55 Å

PDB Description: Aedes aegypti kynurenine aminotrasferase
PDB Compounds: (A:) kynurenine aminotransferase; glutamine transaminase

SCOP Domain Sequences for d1yiza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yiza1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]}
kfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdplan
qytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdeviii
epffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiintp
hnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertitig
sagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlkspe
cyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkdy
rftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss

SCOP Domain Coordinates for d1yiza1:

Click to download the PDB-style file with coordinates for d1yiza1.
(The format of our PDB-style files is described here.)

Timeline for d1yiza1: