![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.67: PLP-dependent transferases [53382] (1 superfamily) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) ![]() |
![]() | Family c.67.1.1: AAT-like [53384] (16 proteins) |
![]() | Protein Kynurenine--oxoglutarate transaminase I [110681] (2 species) |
![]() | Species Yellowfever mosquito (Aedes aegypti) [TaxId:7159] [142654] (2 PDB entries) |
![]() | Domain d1yiya1: 1yiy A:12-429 [123373] complexed with br, pmp |
PDB Entry: 1yiy (more details), 1.9 Å
SCOP Domain Sequences for d1yiya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yiya1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} kfdlpkryqgstksvwveyiqlaaqykplnlgqgfpdyhapkyalnalaaaanspdplan qytrgfghprlvqalsklysqlvdrtinpmtevlvtvgayealyatiqghvdegdeviii epffdcyepmvkaaggiprfiplkpnktggtissadwvldnnelealfnektkmiiintp hnplgkvmdraelevvanlckkwnvlcvsdevyehmvfepfehirictlpgmwertitig sagktfsltgwkigwaygpeallknlqmvhqncvytcatpiqeaiavgfetelkrlkspe cyfnsisgelmakrdymasflaevgmnptvpqggyfmvadwssldskvdltqetdarkdy rftkwmtksvglqgippsafysepnkhlgedfvrycffkkdenlqkaaeilrkwkgss
Timeline for d1yiya1: