Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (26 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [186875] (1 PDB entry) |
Domain d1yixb_: 1yix B: [123372] Other proteins in same PDB: d1yixa1 automated match to d1j6oa_ complexed with zn |
PDB Entry: 1yix (more details), 1.9 Å
SCOPe Domain Sequences for d1yixb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yixb_ c.1.9.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mflvdshchldgldyeslhkdvddvlakaaardvkfclavattlpsylhmrdlvgerdnv vfscgvhplnqndpydvedlrrlaaeegvvalgetgldyyytpetkvrqqesfihhiqig relnkpvivhtrdaradtlailreekvtdcggvlhcftedretagklldlgfyisfsgiv tfrnaeqlrdaaryvpldrllvetdspylapvphrgkenqpamvrdvaeymavlkgvave elaqvttdnfarlfhidasrlqsir
Timeline for d1yixb_: