SCOPe 2.08: Domain d1yixb_: 1yix B:

Lineage for d1yixb_ (1yix B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (36 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [186875] (1 PDB entry)

8. Domain d1yixb_: 1yix B: [123372]
   Other proteins in same PDB: d1yixa1
   automated match to d1j6oa_
   complexed with zn

Details for d1yixb_

PDB Entry: 1yix, 1.9 Å

PDB Description: crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution

PDB Compounds: (B:) deoxyribonuclease ycfH

SCOPe Domain Sequences for d1yixb_:

Sequence; same for both SEQRES and ATOM records:

>d1yixb_ c.1.9.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mflvdshchldgldyeslhkdvddvlakaaardvkfclavattlpsylhmrdlvgerdnv
vfscgvhplnqndpydvedlrrlaaeegvvalgetgldyyytpetkvrqqesfihhiqig
relnkpvivhtrdaradtlailreekvtdcggvlhcftedretagklldlgfyisfsgiv
tfrnaeqlrdaaryvpldrllvetdspylapvphrgkenqpamvrdvaeymavlkgvave
elaqvttdnfarlfhidasrlqsir

Timeline for d1yixb_:

• d1yixb_ first appeared in SCOP 1.73, called d1yixb1
  
• d1yixb_ appears in SCOPe 2.07