Lineage for d1yiwb1 (1yiw B:1-71)

  1. Root: SCOPe 2.02
  2. 1253041Class k: Designed proteins [58788] (44 folds)
  3. 1253658Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 1253659Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 1253660Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 1253661Protein Ubiquitin [144347] (1 species)
  7. 1253662Species Synthetic [144348] (6 PDB entries)
  8. 1253667Domain d1yiwb1: 1yiw B:1-71 [123369]
    automatically matched to 1YIW A:1-71
    complexed with cd, cl

Details for d1yiwb1

PDB Entry: 1yiw (more details), 1.39 Å

PDB Description: x-ray crystal structure of a chemically synthesized ubiquitin
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d1yiwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yiwb1 k.45.1.1 (B:1-71) Ubiquitin {Synthetic}
lqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvl

SCOPe Domain Coordinates for d1yiwb1:

Click to download the PDB-style file with coordinates for d1yiwb1.
(The format of our PDB-style files is described here.)

Timeline for d1yiwb1: