Lineage for d1yiwa1 (1yiw A:1-71)

  1. Root: SCOP 1.73
  2. 757717Class k: Designed proteins [58788] (44 folds)
  3. 758306Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 758307Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 758308Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 758309Protein Ubiquitin [144347] (1 species)
  7. 758310Species synthetic [144348] (6 PDB entries)
  8. 758314Domain d1yiwa1: 1yiw A:1-71 [123368]

Details for d1yiwa1

PDB Entry: 1yiw (more details), 1.39 Å

PDB Description: x-ray crystal structure of a chemically synthesized ubiquitin
PDB Compounds: (A:) Ubiquitin

SCOP Domain Sequences for d1yiwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yiwa1 k.45.1.1 (A:1-71) Ubiquitin {synthetic}
lqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvl

SCOP Domain Coordinates for d1yiwa1:

Click to download the PDB-style file with coordinates for d1yiwa1.
(The format of our PDB-style files is described here.)

Timeline for d1yiwa1: